Temporal fluctuations in HIV quasispecies in vivo are not reflected by sequential HIV isolations
Identifieur interne : 000398 ( France/Analysis ); précédent : 000397; suivant : 000399Temporal fluctuations in HIV quasispecies in vivo are not reflected by sequential HIV isolations
Auteurs : Andreas Meyerhans [France] ; Rémi Cheynier [France] ; Jan Albert [Suède] ; Martina Seth [France] ; Shirley Kwok [États-Unis] ; John Sninsky [États-Unis] ; Linda Morfeldt-M Nson [Suède] ; Birgitta Asjö [Suède] ; Simon Wain-Hobson [France]Source :
- Cell [ 0092-8674 ] ; 1989.
English descriptors
- Teeft :
- Abrupt changes, Aids virus, Amino acid sequence, Amino acid substitutions, Amplification, Background value, Base substitutions, Biological properties, Buffer gradient, Cell count, Cell lines, Clone, Codon, Copy number, Data sets, Defective, Defective genomes, Dominant form, Dominant forms, Dynamic role, Envelope gene, Equimolar mixture, Fetal calf serum, First coding exon, Gene, Gene expression, Genetic variation, Genome, High frequencies, Hindlll, Human immunodeficiency virus, Hybridization, Immune responses, Immunodeficiency, Immunodeficiency syndrome, Internal hindlll, Kpnl, Kpnl sites, Lymphocyte, Major form, Major forms, Major sequences, Mepvdprlepwkhpgsqpkt acnncyckkccfhcqvcftkkglgisygrk krrqrrrapq dsethqvslskq, Minor form, Minor forms, Molecular terms, Nucleic, Nucleic acid seqs, Nucleic acid sequences, Pbmc, Peripheral blood, Plasmid, Point agarose, Polymerase, Polymerase chain reaction, Protein sequence, Protein sequences, Provirus, Quasispecies, Recherche medicale, Recombinant, Remi cheynier, Replication, Room temperature, Sequential, Single adenosine residue, Small sample, Southern blots, Subsequent figures, Substitution, Such complexity, Tissue culture conditions, Unpublished data, Viral, Viral populations, Virol, Virus, Vivo, Year period.
Abstract
Abstract: A genetic study has been made of the HIV tat gene from sequential HIV-1 isolates and the corresponding infected peripheral blood mononuclear cells. DNA was amplified by polymerase chain reaction (PCR) and cloned into a eukaryotic expression vector. Twenty clones were sequenced from each sample. Comparing the sequential HIV isolates, abrupt differences were seen between the major forms of each isolate. These progressive changes were not reflected at all among the in vitro samples. The fluctuation in the quasispecies in vivo may suggest a much more dynamic role for Iatently infected mononuclear cells. High frequencies of functionally defective tat genes were identified. Given such complexity and the evident differences between quasispecies in vivo and in vitro, the task of defining HIV infection in molecular terms will be difficult.
Url:
DOI: 10.1016/0092-8674(89)90942-2
Affiliations:
Links toward previous steps (curation, corpus...)
- to stream Istex, to step Corpus: 002555
- to stream Istex, to step Curation: 002555
- to stream Istex, to step Checkpoint: 002017
- to stream Main, to step Merge: 004B90
- to stream Main, to step Curation: 004B12
- to stream Main, to step Exploration: 004B12
- to stream France, to step Extraction: 000398
Links to Exploration step
ISTEX:016EF36B9CC90729443649F9BA001AF899C5E584Le document en format XML
<record><TEI wicri:istexFullTextTei="biblStruct"><teiHeader><fileDesc><titleStmt><title>Temporal fluctuations in HIV quasispecies in vivo are not reflected by sequential HIV isolations</title>
<author><name sortKey="Meyerhans, Andreas" sort="Meyerhans, Andreas" uniqKey="Meyerhans A" first="Andreas" last="Meyerhans">Andreas Meyerhans</name>
</author>
<author><name sortKey="Cheynier, Remi" sort="Cheynier, Remi" uniqKey="Cheynier R" first="Rémi" last="Cheynier">Rémi Cheynier</name>
</author>
<author><name sortKey="Albert, Jan" sort="Albert, Jan" uniqKey="Albert J" first="Jan" last="Albert">Jan Albert</name>
</author>
<author><name sortKey="Seth, Martina" sort="Seth, Martina" uniqKey="Seth M" first="Martina" last="Seth">Martina Seth</name>
</author>
<author><name sortKey="Kwok, Shirley" sort="Kwok, Shirley" uniqKey="Kwok S" first="Shirley" last="Kwok">Shirley Kwok</name>
</author>
<author><name sortKey="Sninsky, John" sort="Sninsky, John" uniqKey="Sninsky J" first="John" last="Sninsky">John Sninsky</name>
</author>
<author><name sortKey="Morfeldt M Nson, Linda" sort="Morfeldt M Nson, Linda" uniqKey="Morfeldt M Nson L" first="Linda" last="Morfeldt-M Nson">Linda Morfeldt-M Nson</name>
</author>
<author><name sortKey="Asjo, Birgitta" sort="Asjo, Birgitta" uniqKey="Asjo B" first="Birgitta" last="Asjö">Birgitta Asjö</name>
</author>
<author><name sortKey="Wain Hobson, Simon" sort="Wain Hobson, Simon" uniqKey="Wain Hobson S" first="Simon" last="Wain-Hobson">Simon Wain-Hobson</name>
</author>
</titleStmt>
<publicationStmt><idno type="wicri:source">ISTEX</idno>
<idno type="RBID">ISTEX:016EF36B9CC90729443649F9BA001AF899C5E584</idno>
<date when="1989" year="1989">1989</date>
<idno type="doi">10.1016/0092-8674(89)90942-2</idno>
<idno type="url">https://api.istex.fr/ark:/67375/6H6-LSS1LBKZ-2/fulltext.pdf</idno>
<idno type="wicri:Area/Istex/Corpus">002555</idno>
<idno type="wicri:explorRef" wicri:stream="Istex" wicri:step="Corpus" wicri:corpus="ISTEX">002555</idno>
<idno type="wicri:Area/Istex/Curation">002555</idno>
<idno type="wicri:Area/Istex/Checkpoint">002017</idno>
<idno type="wicri:explorRef" wicri:stream="Istex" wicri:step="Checkpoint">002017</idno>
<idno type="wicri:doubleKey">0092-8674:1989:Meyerhans A:temporal:fluctuations:in</idno>
<idno type="wicri:Area/Main/Merge">004B90</idno>
<idno type="wicri:Area/Main/Curation">004B12</idno>
<idno type="wicri:Area/Main/Exploration">004B12</idno>
<idno type="wicri:Area/France/Extraction">000398</idno>
</publicationStmt>
<sourceDesc><biblStruct><analytic><title level="a">Temporal fluctuations in HIV quasispecies in vivo are not reflected by sequential HIV isolations</title>
<author><name sortKey="Meyerhans, Andreas" sort="Meyerhans, Andreas" uniqKey="Meyerhans A" first="Andreas" last="Meyerhans">Andreas Meyerhans</name>
<affiliation wicri:level="1"><country xml:lang="fr">France</country>
<wicri:regionArea>Laboratoire de Biologie et Immunologie Moléculaires des Rétrovirus Institut Pasteur Paris</wicri:regionArea>
</affiliation>
</author>
<author><name sortKey="Cheynier, Remi" sort="Cheynier, Remi" uniqKey="Cheynier R" first="Rémi" last="Cheynier">Rémi Cheynier</name>
<affiliation wicri:level="1"><country xml:lang="fr">France</country>
<wicri:regionArea>Laboratoire de Biologie et Immunologie Moléculaires des Rétrovirus Institut Pasteur Paris</wicri:regionArea>
</affiliation>
</author>
<author><name sortKey="Albert, Jan" sort="Albert, Jan" uniqKey="Albert J" first="Jan" last="Albert">Jan Albert</name>
<affiliation wicri:level="1"><country xml:lang="fr">Suède</country>
<wicri:regionArea>Department of Virology Karolinska Institute Stockholm</wicri:regionArea>
</affiliation>
<affiliation wicri:level="1"><country xml:lang="fr">Suède</country>
<wicri:regionArea>Department of Virology National Bacteriological Laboratory Stockholm</wicri:regionArea>
</affiliation>
</author>
<author><name sortKey="Seth, Martina" sort="Seth, Martina" uniqKey="Seth M" first="Martina" last="Seth">Martina Seth</name>
<affiliation wicri:level="1"><country xml:lang="fr">France</country>
<wicri:regionArea>Laboratoire de Biologie et Immunologie Moléculaires des Rétrovirus Institut Pasteur Paris</wicri:regionArea>
</affiliation>
</author>
<author><name sortKey="Kwok, Shirley" sort="Kwok, Shirley" uniqKey="Kwok S" first="Shirley" last="Kwok">Shirley Kwok</name>
<affiliation wicri:level="2"><country xml:lang="fr">États-Unis</country>
<placeName><region type="state">Californie</region>
</placeName>
<wicri:cityArea>Department of Diagnostic Research Cetus Corporation Emeryville</wicri:cityArea>
</affiliation>
</author>
<author><name sortKey="Sninsky, John" sort="Sninsky, John" uniqKey="Sninsky J" first="John" last="Sninsky">John Sninsky</name>
<affiliation wicri:level="2"><country xml:lang="fr">États-Unis</country>
<placeName><region type="state">Californie</region>
</placeName>
<wicri:cityArea>Department of Diagnostic Research Cetus Corporation Emeryville</wicri:cityArea>
</affiliation>
</author>
<author><name sortKey="Morfeldt M Nson, Linda" sort="Morfeldt M Nson, Linda" uniqKey="Morfeldt M Nson L" first="Linda" last="Morfeldt-M Nson">Linda Morfeldt-M Nson</name>
<affiliation wicri:level="1"><country xml:lang="fr">Suède</country>
<wicri:regionArea>Department of Virology Karolinska Institute Stockholm</wicri:regionArea>
</affiliation>
</author>
<author><name sortKey="Asjo, Birgitta" sort="Asjo, Birgitta" uniqKey="Asjo B" first="Birgitta" last="Asjö">Birgitta Asjö</name>
<affiliation wicri:level="1"><country xml:lang="fr">Suède</country>
<wicri:regionArea>Department of Virology Karolinska Institute Stockholm</wicri:regionArea>
</affiliation>
</author>
<author><name sortKey="Wain Hobson, Simon" sort="Wain Hobson, Simon" uniqKey="Wain Hobson S" first="Simon" last="Wain-Hobson">Simon Wain-Hobson</name>
<affiliation wicri:level="1"><country xml:lang="fr">France</country>
<wicri:regionArea>Laboratoire de Biologie et Immunologie Moléculaires des Rétrovirus Institut Pasteur Paris</wicri:regionArea>
</affiliation>
</author>
</analytic>
<monogr></monogr>
<series><title level="j">Cell</title>
<title level="j" type="abbrev">CELL</title>
<idno type="ISSN">0092-8674</idno>
<imprint><publisher>ELSEVIER</publisher>
<date type="published" when="1989">1989</date>
<biblScope unit="volume">58</biblScope>
<biblScope unit="issue">5</biblScope>
<biblScope unit="page" from="901">901</biblScope>
<biblScope unit="page" to="910">910</biblScope>
</imprint>
<idno type="ISSN">0092-8674</idno>
</series>
</biblStruct>
</sourceDesc>
<seriesStmt><idno type="ISSN">0092-8674</idno>
</seriesStmt>
</fileDesc>
<profileDesc><textClass><keywords scheme="Teeft" xml:lang="en"><term>Abrupt changes</term>
<term>Aids virus</term>
<term>Amino acid sequence</term>
<term>Amino acid substitutions</term>
<term>Amplification</term>
<term>Background value</term>
<term>Base substitutions</term>
<term>Biological properties</term>
<term>Buffer gradient</term>
<term>Cell count</term>
<term>Cell lines</term>
<term>Clone</term>
<term>Codon</term>
<term>Copy number</term>
<term>Data sets</term>
<term>Defective</term>
<term>Defective genomes</term>
<term>Dominant form</term>
<term>Dominant forms</term>
<term>Dynamic role</term>
<term>Envelope gene</term>
<term>Equimolar mixture</term>
<term>Fetal calf serum</term>
<term>First coding exon</term>
<term>Gene</term>
<term>Gene expression</term>
<term>Genetic variation</term>
<term>Genome</term>
<term>High frequencies</term>
<term>Hindlll</term>
<term>Human immunodeficiency virus</term>
<term>Hybridization</term>
<term>Immune responses</term>
<term>Immunodeficiency</term>
<term>Immunodeficiency syndrome</term>
<term>Internal hindlll</term>
<term>Kpnl</term>
<term>Kpnl sites</term>
<term>Lymphocyte</term>
<term>Major form</term>
<term>Major forms</term>
<term>Major sequences</term>
<term>Mepvdprlepwkhpgsqpkt acnncyckkccfhcqvcftkkglgisygrk krrqrrrapq dsethqvslskq</term>
<term>Minor form</term>
<term>Minor forms</term>
<term>Molecular terms</term>
<term>Nucleic</term>
<term>Nucleic acid seqs</term>
<term>Nucleic acid sequences</term>
<term>Pbmc</term>
<term>Peripheral blood</term>
<term>Plasmid</term>
<term>Point agarose</term>
<term>Polymerase</term>
<term>Polymerase chain reaction</term>
<term>Protein sequence</term>
<term>Protein sequences</term>
<term>Provirus</term>
<term>Quasispecies</term>
<term>Recherche medicale</term>
<term>Recombinant</term>
<term>Remi cheynier</term>
<term>Replication</term>
<term>Room temperature</term>
<term>Sequential</term>
<term>Single adenosine residue</term>
<term>Small sample</term>
<term>Southern blots</term>
<term>Subsequent figures</term>
<term>Substitution</term>
<term>Such complexity</term>
<term>Tissue culture conditions</term>
<term>Unpublished data</term>
<term>Viral</term>
<term>Viral populations</term>
<term>Virol</term>
<term>Virus</term>
<term>Vivo</term>
<term>Year period</term>
</keywords>
</textClass>
<langUsage><language ident="en">en</language>
</langUsage>
</profileDesc>
</teiHeader>
<front><div type="abstract" xml:lang="en">Abstract: A genetic study has been made of the HIV tat gene from sequential HIV-1 isolates and the corresponding infected peripheral blood mononuclear cells. DNA was amplified by polymerase chain reaction (PCR) and cloned into a eukaryotic expression vector. Twenty clones were sequenced from each sample. Comparing the sequential HIV isolates, abrupt differences were seen between the major forms of each isolate. These progressive changes were not reflected at all among the in vitro samples. The fluctuation in the quasispecies in vivo may suggest a much more dynamic role for Iatently infected mononuclear cells. High frequencies of functionally defective tat genes were identified. Given such complexity and the evident differences between quasispecies in vivo and in vitro, the task of defining HIV infection in molecular terms will be difficult.</div>
</front>
</TEI>
<affiliations><list><country><li>France</li>
<li>Suède</li>
<li>États-Unis</li>
</country>
<region><li>Californie</li>
</region>
</list>
<tree><country name="France"><noRegion><name sortKey="Meyerhans, Andreas" sort="Meyerhans, Andreas" uniqKey="Meyerhans A" first="Andreas" last="Meyerhans">Andreas Meyerhans</name>
</noRegion>
<name sortKey="Cheynier, Remi" sort="Cheynier, Remi" uniqKey="Cheynier R" first="Rémi" last="Cheynier">Rémi Cheynier</name>
<name sortKey="Seth, Martina" sort="Seth, Martina" uniqKey="Seth M" first="Martina" last="Seth">Martina Seth</name>
<name sortKey="Wain Hobson, Simon" sort="Wain Hobson, Simon" uniqKey="Wain Hobson S" first="Simon" last="Wain-Hobson">Simon Wain-Hobson</name>
</country>
<country name="Suède"><noRegion><name sortKey="Albert, Jan" sort="Albert, Jan" uniqKey="Albert J" first="Jan" last="Albert">Jan Albert</name>
</noRegion>
<name sortKey="Albert, Jan" sort="Albert, Jan" uniqKey="Albert J" first="Jan" last="Albert">Jan Albert</name>
<name sortKey="Asjo, Birgitta" sort="Asjo, Birgitta" uniqKey="Asjo B" first="Birgitta" last="Asjö">Birgitta Asjö</name>
<name sortKey="Morfeldt M Nson, Linda" sort="Morfeldt M Nson, Linda" uniqKey="Morfeldt M Nson L" first="Linda" last="Morfeldt-M Nson">Linda Morfeldt-M Nson</name>
</country>
<country name="États-Unis"><region name="Californie"><name sortKey="Kwok, Shirley" sort="Kwok, Shirley" uniqKey="Kwok S" first="Shirley" last="Kwok">Shirley Kwok</name>
</region>
<name sortKey="Sninsky, John" sort="Sninsky, John" uniqKey="Sninsky J" first="John" last="Sninsky">John Sninsky</name>
</country>
</tree>
</affiliations>
</record>
Pour manipuler ce document sous Unix (Dilib)
EXPLOR_STEP=$WICRI_ROOT/Sante/explor/MersV1/Data/France/Analysis
HfdSelect -h $EXPLOR_STEP/biblio.hfd -nk 000398 | SxmlIndent | more
Ou
HfdSelect -h $EXPLOR_AREA/Data/France/Analysis/biblio.hfd -nk 000398 | SxmlIndent | more
Pour mettre un lien sur cette page dans le réseau Wicri
{{Explor lien |wiki= Sante |area= MersV1 |flux= France |étape= Analysis |type= RBID |clé= ISTEX:016EF36B9CC90729443649F9BA001AF899C5E584 |texte= Temporal fluctuations in HIV quasispecies in vivo are not reflected by sequential HIV isolations }}
This area was generated with Dilib version V0.6.33. |